RABEPK monoclonal antibody (M01), clone 4C9 View larger

RABEPK monoclonal antibody (M01), clone 4C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RABEPK monoclonal antibody (M01), clone 4C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RABEPK monoclonal antibody (M01), clone 4C9

Brand: Abnova
Reference: H00010244-M01
Product name: RABEPK monoclonal antibody (M01), clone 4C9
Product description: Mouse monoclonal antibody raised against a partial recombinant RABEPK.
Clone: 4C9
Isotype: IgG2a Kappa
Gene id: 10244
Gene name: RABEPK
Gene alias: DKFZp686P1077|RAB9P40|bA65N13.1|p40
Gene description: Rab9 effector protein with kelch motifs
Genbank accession: NM_005833
Immunogen: RABEPK (NP_005824.2, 273 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD
Protein accession: NP_005824.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010244-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010244-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RABEPK is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RABEPK monoclonal antibody (M01), clone 4C9 now

Add to cart