CALCOCO2 monoclonal antibody (M07), clone 1A11 View larger

CALCOCO2 monoclonal antibody (M07), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CALCOCO2 monoclonal antibody (M07), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr

More info about CALCOCO2 monoclonal antibody (M07), clone 1A11

Brand: Abnova
Reference: H00010241-M07
Product name: CALCOCO2 monoclonal antibody (M07), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant CALCOCO2.
Clone: 1A11
Isotype: IgG2b Kappa
Gene id: 10241
Gene name: CALCOCO2
Gene alias: MGC17318|NDP52
Gene description: calcium binding and coiled-coil domain 2
Genbank accession: NM_005831
Immunogen: CALCOCO2 (NP_005822, 347 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Protein accession: NP_005822
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010241-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010241-M07-13-15-1.jpg
Application image note: Western Blot analysis of CALCOCO2 expression in transfected 293T cell line by CALCOCO2 monoclonal antibody (M07), clone 1A11.

Lane 1: CALCOCO2 transfected lysate (Predicted MW: 52.3 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CALCOCO2 monoclonal antibody (M07), clone 1A11 now

Add to cart