Brand: | Abnova |
Reference: | H00010235-M09 |
Product name: | RASGRP2 monoclonal antibody (M09), clone 3D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RASGRP2. |
Clone: | 3D8 |
Isotype: | IgG2a Kappa |
Gene id: | 10235 |
Gene name: | RASGRP2 |
Gene alias: | CALDAG-GEFI|CDC25L |
Gene description: | RAS guanyl releasing protein 2 (calcium and DAG-regulated) |
Genbank accession: | NM_005825 |
Immunogen: | RASGRP2 (NP_005816, 65 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKE |
Protein accession: | NP_005816 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RASGRP2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Calcium-Diacylglycerol Guanine Nucleotide Exchange Factor I (CalDAG-GEFI) gene mutations associated with loss of function in canine platelets.Boudreaux MK, Catalfamo JL, Klok M. Transl Res. 2007 Aug;150(2):81-92. Epub 2007 May 25. |