Brand: | Abnova |
Reference: | H00010220-M09 |
Product name: | GDF11 monoclonal antibody (M09), clone 1E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GDF11. |
Clone: | 1E11 |
Isotype: | IgG2a Kappa |
Gene id: | 10220 |
Gene name: | GDF11 |
Gene alias: | BMP-11|BMP11 |
Gene description: | growth differentiation factor 11 |
Genbank accession: | NM_005811 |
Immunogen: | GDF11 (NP_005802, 310 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
Protein accession: | NP_005802 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00010220-M09-9-19-1.jpg](http://www.abnova.com/application_image/H00010220-M09-9-19-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged GDF11 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |