Brand: | Abnova |
Reference: | H00010218-M02 |
Product name: | ANGPTL7 monoclonal antibody (M02), clone 3E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ANGPTL7. |
Clone: | 3E7 |
Isotype: | IgG2a Kappa |
Gene id: | 10218 |
Gene name: | ANGPTL7 |
Gene alias: | AngX|CDT6|RP4-647M16.2|dJ647M16.1 |
Gene description: | angiopoietin-like 7 |
Genbank accession: | NM_021146 |
Immunogen: | ANGPTL7 (NP_066969, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSAD |
Protein accession: | NP_066969 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00010218-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00010218-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00010218-M02-3-6-1-L.jpg](http://www.abnova.com/application_image/H00010218-M02-3-6-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to ANGPTL7 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |