Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRG4 monoclonal antibody (M01A), clone 2A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | ELISA |
More info about PRG4 monoclonal antibody (M01A), clone 2A6
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRG4. |
| Clone: | 2A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10216 |
| Gene name: | PRG4 |
| Gene alias: | CACP|FLJ32635|HAPO|JCAP|MSF|SZP|bG174L6.2 |
| Gene description: | proteoglycan 4 |
| Genbank accession: | NM_005807 |
| Immunogen: | PRG4 (NP_005798, 1305 a.a. ~ 1404 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP |
| Protein accession: | NP_005798 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 200 uL |
| Shipping condition: | Dry Ice |