Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of OLIG2 monoclonal antibody (M05), clone 2A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about OLIG2 monoclonal antibody (M05), clone 2A8
| Brand: | Abnova |
| Reference: | H00010215-M05 |
| Product name: | OLIG2 monoclonal antibody (M05), clone 2A8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant OLIG2. |
| Clone: | 2A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10215 |
| Gene name: | OLIG2 |
| Gene alias: | BHLHB1|OLIGO2|PRKCBP2|RACK17|bHLHe19 |
| Gene description: | oligodendrocyte lineage transcription factor 2 |
| Genbank accession: | NM_005806 |
| Immunogen: | OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS |
| Protein accession: | NP_005797 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.47 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of OLIG2 expression in transfected 293T cell line by OLIG2 monoclonal antibody (M05), clone 2A8. Lane 1: OLIG2 transfected lysate(32.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |