Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010214-M03 |
Product name: | SSX3 monoclonal antibody (M03), clone 4A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SSX3. |
Clone: | 4A11 |
Isotype: | IgG2a Kappa |
Gene id: | 10214 |
Gene name: | SSX3 |
Gene alias: | MGC119054|MGC14495 |
Gene description: | synovial sarcoma, X breakpoint 3 |
Genbank accession: | NM_021014 |
Immunogen: | SSX3 (NP_066294, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMT |
Protein accession: | NP_066294 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SSX3 expression in transfected 293T cell line by SSX3 monoclonal antibody (M03), clone 4A11. Lane 1: SSX3 transfected lysate(21.697 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |