Brand: | Abnova |
Reference: | H00010210-M02 |
Product name: | TOPORS monoclonal antibody (M02), clone 4G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TOPORS. |
Clone: | 4G4 |
Isotype: | IgG2a Kappa |
Gene id: | 10210 |
Gene name: | TOPORS |
Gene alias: | LUN|P53BP3|RP31|TP53BPL |
Gene description: | topoisomerase I binding, arginine/serine-rich |
Genbank accession: | NM_005802 |
Immunogen: | TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT |
Protein accession: | NP_005793 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00010210-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00010210-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00010210-M02-9-19-1.jpg](http://www.abnova.com/application_image/H00010210-M02-9-19-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged TOPORS is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |