TOPORS monoclonal antibody (M02), clone 4G4 View larger

TOPORS monoclonal antibody (M02), clone 4G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TOPORS monoclonal antibody (M02), clone 4G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about TOPORS monoclonal antibody (M02), clone 4G4

Brand: Abnova
Reference: H00010210-M02
Product name: TOPORS monoclonal antibody (M02), clone 4G4
Product description: Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Clone: 4G4
Isotype: IgG2a Kappa
Gene id: 10210
Gene name: TOPORS
Gene alias: LUN|P53BP3|RP31|TP53BPL
Gene description: topoisomerase I binding, arginine/serine-rich
Genbank accession: NM_005802
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
Protein accession: NP_005793
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010210-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010210-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TOPORS is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TOPORS monoclonal antibody (M02), clone 4G4 now

Add to cart