Brand: | Abnova |
Reference: | H00010210-M01 |
Product name: | TOPORS monoclonal antibody (M01), clone 5G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TOPORS. |
Clone: | 5G11 |
Isotype: | IgG2a Kappa |
Gene id: | 10210 |
Gene name: | TOPORS |
Gene alias: | LUN|P53BP3|RP31|TP53BPL |
Gene description: | topoisomerase I binding, arginine/serine-rich |
Genbank accession: | NM_005802 |
Immunogen: | TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT |
Protein accession: | NP_005793 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00010210-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00010210-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00010210-M01-3-21-1-L.jpg](http://www.abnova.com/application_image/H00010210-M01-3-21-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to TOPORS on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Mitotic Phosphorylation Stimulates DNA Relaxation Activity of Human Topoisomerase I.Hackbarth JS, Galvez-Peralta M, Dai NT, Loegering DA, Peterson KL, Meng XW, Karnitz LM, Kaufmann SH. J Biol Chem. 2008 Jun 13;283(24):16711-22. Epub 2008 Apr 11. |