Brand: | Abnova |
Reference: | H00010209-M01A |
Product name: | EIF1 monoclonal antibody (M01A), clone 2E1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant EIF1. |
Clone: | 2E1 |
Isotype: | IgM Kappa |
Gene id: | 10209 |
Gene name: | EIF1 |
Gene alias: | A121|EIF-1|EIF1A|ISO1|SUI1 |
Gene description: | eukaryotic translation initiation factor 1 |
Genbank accession: | BC005118 |
Immunogen: | EIF1 (AAH05118, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF |
Protein accession: | AAH05118 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.17 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |