TRIM13 monoclonal antibody (M02), clone 1E5 View larger

TRIM13 monoclonal antibody (M02), clone 1E5

H00010206-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM13 monoclonal antibody (M02), clone 1E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TRIM13 monoclonal antibody (M02), clone 1E5

Brand: Abnova
Reference: H00010206-M02
Product name: TRIM13 monoclonal antibody (M02), clone 1E5
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM13.
Clone: 1E5
Isotype: IgG1 Kappa
Gene id: 10206
Gene name: TRIM13
Gene alias: CAR|DLEU5|LEU5|RFP2|RNF77
Gene description: tripartite motif-containing 13
Genbank accession: NM_005798
Immunogen: TRIM13 (NP_005789, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
Protein accession: NP_005789
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010206-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TRIM13 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TRIM13 monoclonal antibody (M02), clone 1E5 now

Add to cart