RFP2 monoclonal antibody (M01), clone 2A11 View larger

RFP2 monoclonal antibody (M01), clone 2A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RFP2 monoclonal antibody (M01), clone 2A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RFP2 monoclonal antibody (M01), clone 2A11

Brand: Abnova
Reference: H00010206-M01
Product name: RFP2 monoclonal antibody (M01), clone 2A11
Product description: Mouse monoclonal antibody raised against a partial recombinant RFP2.
Clone: 2A11
Isotype: IgG2a lambda
Gene id: 10206
Gene name: TRIM13
Gene alias: CAR|DLEU5|LEU5|RFP2|RNF77
Gene description: tripartite motif-containing 13
Genbank accession: NM_005798
Immunogen: RFP2 (NP_005789, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
Protein accession: NP_005789
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010206-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged RFP2 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy RFP2 monoclonal antibody (M01), clone 2A11 now

Add to cart