RFP2 polyclonal antibody (A01) View larger

RFP2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RFP2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RFP2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010206-A01
Product name: RFP2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RFP2.
Gene id: 10206
Gene name: TRIM13
Gene alias: CAR|DLEU5|LEU5|RFP2|RNF77
Gene description: tripartite motif-containing 13
Genbank accession: NM_005798
Immunogen: RFP2 (NP_005789, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
Protein accession: NP_005789
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010206-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010206-A01-1-1-1.jpg
Application image note: RFP2 polyclonal antibody (A01), Lot # UYL6060127QCS1 Western Blot analysis of RFP2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RFP2 polyclonal antibody (A01) now

Add to cart