MPZL2 purified MaxPab mouse polyclonal antibody (B01P) View larger

MPZL2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPZL2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MPZL2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010205-B01P
Product name: MPZL2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MPZL2 protein.
Gene id: 10205
Gene name: MPZL2
Gene alias: EVA|EVA1
Gene description: myelin protein zero-like 2
Genbank accession: NM_005797.2
Immunogen: MPZL2 (NP_005788.1, 1 a.a. ~ 215 a.a) full-length human protein.
Immunogen sequence/protein sequence: MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
Protein accession: NP_005788.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010205-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MPZL2 expression in transfected 293T cell line (H00010205-T01) by MPZL2 MaxPab polyclonal antibody.

Lane 1: MPZL2 transfected lysate(23.65 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MPZL2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart