DHRS2 monoclonal antibody (M03), clone 1F10 View larger

DHRS2 monoclonal antibody (M03), clone 1F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHRS2 monoclonal antibody (M03), clone 1F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DHRS2 monoclonal antibody (M03), clone 1F10

Brand: Abnova
Reference: H00010202-M03
Product name: DHRS2 monoclonal antibody (M03), clone 1F10
Product description: Mouse monoclonal antibody raised against a partial recombinant DHRS2.
Clone: 1F10
Isotype: IgG2a Kappa
Gene id: 10202
Gene name: DHRS2
Gene alias: HEP27|SDR25C1
Gene description: dehydrogenase/reductase (SDR family) member 2
Genbank accession: NM_182908
Immunogen: DHRS2 (NP_878912.1, 229 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GFMGMSLSGRTSRNIISCRGLGSQRTVQESCPSCALQMPATSTGRTLRWQATPLGSERSGGGCVAVVPGPGA
Protein accession: NP_878912.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010202-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010202-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged DHRS2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DHRS2 monoclonal antibody (M03), clone 1F10 now

Add to cart