Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010201-M07 |
Product name: | NME6 monoclonal antibody (M07), clone 2A10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant NME6. |
Clone: | 2A10 |
Isotype: | IgG2a Kappa |
Gene id: | 10201 |
Gene name: | NME6 |
Gene alias: | IPIA-ALPHA|NM23-H6 |
Gene description: | non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) |
Genbank accession: | BC001808 |
Immunogen: | NME6 (AAH01808, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA |
Protein accession: | AAH01808 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (47.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NME6 expression in transfected 293T cell line by NME6 monoclonal antibody (M07), clone 2A10. Lane 1: NME6 transfected lysate(22 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |