NME6 purified MaxPab mouse polyclonal antibody (B03P) View larger

NME6 purified MaxPab mouse polyclonal antibody (B03P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NME6 purified MaxPab mouse polyclonal antibody (B03P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NME6 purified MaxPab mouse polyclonal antibody (B03P)

Brand: Abnova
Reference: H00010201-B03P
Product name: NME6 purified MaxPab mouse polyclonal antibody (B03P)
Product description: Mouse polyclonal antibody raised against a full-length human NME6 protein.
Gene id: 10201
Gene name: NME6
Gene alias: IPIA-ALPHA|NM23-H6
Gene description: non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase)
Genbank accession: BC001808
Immunogen: NME6 (AAH01808.1, 1 a.a. ~ 194 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
Protein accession: AAH01808.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010201-B03P-13-15-1.jpg
Application image note: Western Blot analysis of NME6 expression in transfected 293T cell line (H00010201-T03) by NME6 MaxPab polyclonal antibody.

Lane 1: NME6 transfected lysate(21.34 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NME6 purified MaxPab mouse polyclonal antibody (B03P) now

Add to cart