MPHOSPH6 monoclonal antibody (M11), clone 4F11 View larger

MPHOSPH6 monoclonal antibody (M11), clone 4F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPHOSPH6 monoclonal antibody (M11), clone 4F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MPHOSPH6 monoclonal antibody (M11), clone 4F11

Brand: Abnova
Reference: H00010200-M11
Product name: MPHOSPH6 monoclonal antibody (M11), clone 4F11
Product description: Mouse monoclonal antibody raised against a full-length recombinant MPHOSPH6.
Clone: 4F11
Isotype: IgG2a Kappa
Gene id: 10200
Gene name: MPHOSPH6
Gene alias: MPP|MPP-6|MPP6
Gene description: M-phase phosphoprotein 6
Genbank accession: BC005242
Immunogen: MPHOSPH6 (AAH05242, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD
Protein accession: AAH05242
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010200-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010200-M11-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MPHOSPH6 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MPHOSPH6 monoclonal antibody (M11), clone 4F11 now

Add to cart