MPHOSPH9 monoclonal antibody (M10), clone 4E10 View larger

MPHOSPH9 monoclonal antibody (M10), clone 4E10

H00010198-M10_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPHOSPH9 monoclonal antibody (M10), clone 4E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about MPHOSPH9 monoclonal antibody (M10), clone 4E10

Brand: Abnova
Reference: H00010198-M10
Product name: MPHOSPH9 monoclonal antibody (M10), clone 4E10
Product description: Mouse monoclonal antibody raised against a partial recombinant MPHOSPH9.
Clone: 4E10
Isotype: IgG2a Kappa
Gene id: 10198
Gene name: MPHOSPH9
Gene alias: DKFZp434J034|FLJ12954|MPP-9|MPP9
Gene description: M-phase phosphoprotein 9
Genbank accession: NM_022782
Immunogen: MPHOSPH9 (NP_073619, 922 a.a. ~ 1031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL
Protein accession: NP_073619
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010198-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010198-M10-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MPHOSPH9 is approximately 1ng/ml as a capture antibody.
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MPHOSPH9 monoclonal antibody (M10), clone 4E10 now

Add to cart