H00010198-M10_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010198-M10 |
Product name: | MPHOSPH9 monoclonal antibody (M10), clone 4E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MPHOSPH9. |
Clone: | 4E10 |
Isotype: | IgG2a Kappa |
Gene id: | 10198 |
Gene name: | MPHOSPH9 |
Gene alias: | DKFZp434J034|FLJ12954|MPP-9|MPP9 |
Gene description: | M-phase phosphoprotein 9 |
Genbank accession: | NM_022782 |
Immunogen: | MPHOSPH9 (NP_073619, 922 a.a. ~ 1031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL |
Protein accession: | NP_073619 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged MPHOSPH9 is approximately 1ng/ml as a capture antibody. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |