Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00010197-B01P |
Product name: | PSME3 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human PSME3 protein. |
Gene id: | 10197 |
Gene name: | PSME3 |
Gene alias: | Ki|PA28-gamma|PA28G|REG-GAMMA |
Gene description: | proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) |
Genbank accession: | BC001423.1 |
Immunogen: | PSME3 (AAH01423.1, 1 a.a. ~ 254 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDVNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY |
Protein accession: | AAH01423.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PSME3 expression in transfected 293T cell line (H00010197-T01) by PSME3 MaxPab polyclonal antibody. Lane 1: PSME3 transfected lysate(28.05 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |