Brand: | Abnova |
Reference: | H00010196-M16 |
Product name: | PRMT3 monoclonal antibody (M16), clone 3G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRMT3. |
Clone: | 3G4 |
Isotype: | IgG1 Kappa |
Gene id: | 10196 |
Gene name: | PRMT3 |
Gene alias: | HRMT1L3 |
Gene description: | protein arginine methyltransferase 3 |
Genbank accession: | NM_005788 |
Immunogen: | PRMT3 (NP_005779, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLY |
Protein accession: | NP_005779 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PRMT3 monoclonal antibody (M16), clone 3G4. Western Blot analysis of PRMT3 expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |