Brand: | Abnova |
Reference: | H00010188-A01 |
Product name: | TNK2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TNK2. |
Gene id: | 10188 |
Gene name: | TNK2 |
Gene alias: | ACK|ACK1|FLJ44758|FLJ45547|p21cdc42Hs |
Gene description: | tyrosine kinase, non-receptor, 2 |
Genbank accession: | BC008884 |
Immunogen: | TNK2 (AAH08884, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCL |
Protein accession: | AAH08884 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TNK2 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of TNK2 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |