Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RBM5 monoclonal antibody (M01), clone 2B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about RBM5 monoclonal antibody (M01), clone 2B6
| Brand: | Abnova |
| Reference: | H00010181-M01 |
| Product name: | RBM5 monoclonal antibody (M01), clone 2B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RBM5. |
| Clone: | 2B6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10181 |
| Gene name: | RBM5 |
| Gene alias: | FLJ39876|G15|H37|LUCA15|RMB5 |
| Gene description: | RNA binding motif protein 5 |
| Genbank accession: | BC002957 |
| Immunogen: | RBM5 (AAH02957, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFED |
| Protein accession: | AAH02957 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RBM5 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |