Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ODZ1 monoclonal antibody (M01), clone 3G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about ODZ1 monoclonal antibody (M01), clone 3G8
| Brand: | Abnova |
| Reference: | H00010178-M01 |
| Product name: | ODZ1 monoclonal antibody (M01), clone 3G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ODZ1. |
| Clone: | 3G8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10178 |
| Gene name: | ODZ1 |
| Gene alias: | ODZ3|TEN-M1|TNM|TNM1 |
| Gene description: | odz, odd Oz/ten-m homolog 1(Drosophila) |
| Genbank accession: | NM_014253 |
| Immunogen: | ODZ1 (NP_055068, 2616 a.a. ~ 2725 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR |
| Protein accession: | NP_055068 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ODZ1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | C-terminal region of teneurin-1 co-localizes with the dystroglycan complex in adult mouse testes and regulates testicular size and testosterone production.Chand D, Colacci M, Dixon K, Kollara A, Brown TJ, Lovejoy DA Histochem Cell Biol. 2013 Oct 24. |