Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DHRS9 monoclonal antibody (M05), clone 3C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
More info about DHRS9 monoclonal antibody (M05), clone 3C6
| Brand: | Abnova |
| Reference: | H00010170-M05 |
| Product name: | DHRS9 monoclonal antibody (M05), clone 3C6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant DHRS9. |
| Clone: | 3C6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10170 |
| Gene name: | DHRS9 |
| Gene alias: | 3ALPHA-HSD|RDH15|RDHL|RDHTBE|RETSDR8|SDR9C4 |
| Gene description: | dehydrogenase/reductase (SDR family) member 9 |
| Genbank accession: | BC058883 |
| Immunogen: | DHRS9 (AAH58883, 1 a.a. ~ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV |
| Protein accession: | AAH58883 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (60.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to DHRS9 on HeLa cell . [antibody concentration 5 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | DHRS9 is a Stable Marker of Human Regulatory Macrophages.Riquelme P, Amodio G, Macedo C, Moreau A, Obermajer N, Brochhausen C, Ahrens N, Kekarainen T, Fandrich F, Cuturi C, Gregori S, Metes D, Schlitt HJ, Thomson AW, Geissler EK, Hutchinson JA. Transplantation. 2017 Jun 7. [Epub ahead of print] |