Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DHRS9 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about DHRS9 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00010170-B01P |
| Product name: | DHRS9 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human DHRS9 protein. |
| Gene id: | 10170 |
| Gene name: | DHRS9 |
| Gene alias: | 3ALPHA-HSD|RDH15|RDHL|RDHTBE|RETSDR8|SDR9C4 |
| Gene description: | dehydrogenase/reductase (SDR family) member 9 |
| Genbank accession: | NM_005771.3 |
| Immunogen: | DHRS9 (NP_005762.2, 1 a.a. ~ 319 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV |
| Protein accession: | NP_005762.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DHRS9 expression in transfected 293T cell line (H00010170-T01) by DHRS9 MaxPab polyclonal antibody. Lane 1: DHRS9 transfected lysate(35.09 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Downregulation of DHRS9 expression in colorectal cancer tissues and its prognostic significance.Hu L, Chen HY, Han T, Yang GZ, Feng D, Qi CY, Gong H, Zhai YX, Cai QP, Gao CF. Tumour Biol. 2015 Aug 8. [Epub ahead of print] |