Brand: | Abnova |
Reference: | H00010165-M01 |
Product name: | SLC25A13 monoclonal antibody (M01), clone 4F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC25A13. |
Clone: | 4F4 |
Isotype: | IgG2a Kappa |
Gene id: | 10165 |
Gene name: | SLC25A13 |
Gene alias: | ARALAR2|CITRIN|CTLN2 |
Gene description: | solute carrier family 25, member 13 (citrin) |
Genbank accession: | NM_014251 |
Immunogen: | SLC25A13 (NP_055066, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVA |
Protein accession: | NP_055066 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to SLC25A13 on HepG2 cell. [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |