FARP1 monoclonal antibody (M01), clone 2D4 View larger

FARP1 monoclonal antibody (M01), clone 2D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FARP1 monoclonal antibody (M01), clone 2D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about FARP1 monoclonal antibody (M01), clone 2D4

Brand: Abnova
Reference: H00010160-M01
Product name: FARP1 monoclonal antibody (M01), clone 2D4
Product description: Mouse monoclonal antibody raised against a partial recombinant FARP1.
Clone: 2D4
Isotype: IgG2a Kappa
Gene id: 10160
Gene name: FARP1
Gene alias: CDEP|MGC87400|PLEKHC2
Gene description: FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
Genbank accession: NM_005766
Immunogen: FARP1 (NP_005757.1, 471 a.a. ~ 549 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVS
Protein accession: NP_005757.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010160-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010160-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to FARP1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FARP1 monoclonal antibody (M01), clone 2D4 now

Add to cart