Brand: | Abnova |
Reference: | H00010154-M06 |
Product name: | PLXNC1 monoclonal antibody (M06), clone 1A12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLXNC1. |
Clone: | 1A12 |
Isotype: | IgG2b Kappa |
Gene id: | 10154 |
Gene name: | PLXNC1 |
Gene alias: | CD232|PLXN-C1|VESPR |
Gene description: | plexin C1 |
Genbank accession: | NM_005761 |
Immunogen: | PLXNC1 (NP_005752, 250 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFK |
Protein accession: | NP_005752 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PLXNC1 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |