Brand: | Abnova |
Reference: | H00010148-M01 |
Product name: | EBI3 monoclonal antibody (M01), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EBI3. (Please notice that this antibody can't conjugate with biotin, biotinylation will lead to lost of antibody specificity) |
Clone: | 1D3 |
Isotype: | IgG2a Kappa |
Gene id: | 10148 |
Gene name: | EBI3 |
Gene alias: | IL27B |
Gene description: | Epstein-Barr virus induced 3 |
Genbank accession: | NM_005755 |
Immunogen: | EBI3 (NP_005746, 129 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
Protein accession: | NP_005746 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EBI3 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |