AKAP9 monoclonal antibody (M07), clone 7E12 View larger

AKAP9 monoclonal antibody (M07), clone 7E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKAP9 monoclonal antibody (M07), clone 7E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about AKAP9 monoclonal antibody (M07), clone 7E12

Brand: Abnova
Reference: H00010142-M07
Product name: AKAP9 monoclonal antibody (M07), clone 7E12
Product description: Mouse monoclonal antibody raised against a partial recombinant AKAP9.
Clone: 7E12
Isotype: IgG2a Kappa
Gene id: 10142
Gene name: AKAP9
Gene alias: AKAP350|AKAP450|CG-NAP|HYPERION|KIAA0803|MU-RMS-40.16A|PRKA9|YOTIAO
Gene description: A kinase (PRKA) anchor protein (yotiao) 9
Genbank accession: NM_147171
Immunogen: AKAP9 (NP_671700, 3812 a.a. ~ 3911 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR
Protein accession: NP_671700
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010142-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010142-M07-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to AKAP9 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AKAP9 monoclonal antibody (M07), clone 7E12 now

Add to cart