Brand: | Abnova |
Reference: | H00010142-M01 |
Product name: | AKAP9 monoclonal antibody (M01), clone 1A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKAP9. |
Clone: | 1A6 |
Isotype: | IgG2a Kappa |
Gene id: | 10142 |
Gene name: | AKAP9 |
Gene alias: | AKAP350|AKAP450|CG-NAP|HYPERION|KIAA0803|MU-RMS-40.16A|PRKA9|YOTIAO |
Gene description: | A kinase (PRKA) anchor protein (yotiao) 9 |
Genbank accession: | NM_147171 |
Immunogen: | AKAP9 (NP_671700, 3812 a.a. ~ 3911 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR |
Protein accession: | NP_671700 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged AKAP9 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |