Brand: | Abnova |
Reference: | H00010141-M01 |
Product name: | C4orf6 monoclonal antibody (M01), clone 3F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C4orf6. |
Clone: | 3F12 |
Isotype: | IgG2b Kappa |
Gene id: | 10141 |
Gene name: | C4orf6 |
Gene alias: | aC1 |
Gene description: | chromosome 4 open reading frame 6 |
Genbank accession: | NM_005750 |
Immunogen: | C4orf6 (NP_005741, 1 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFAASWTFDPNPSVTVSGAHSTAVHQ |
Protein accession: | NP_005741 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |