Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARFRP1 purified MaxPab mouse polyclonal antibody (B03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about ARFRP1 purified MaxPab mouse polyclonal antibody (B03P)
| Brand: | Abnova |
| Reference: | H00010139-B03P |
| Product name: | ARFRP1 purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ARFRP1 protein. |
| Gene id: | 10139 |
| Gene name: | ARFRP1 |
| Gene alias: | ARL18|ARP|Arp1 |
| Gene description: | ADP-ribosylation factor related protein 1 |
| Genbank accession: | NM_003224 |
| Immunogen: | ARFRP1 (NP_003215.1, 1 a.a. ~ 201 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT |
| Protein accession: | NP_003215.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ARFRP1 expression in transfected 293T cell line (H00010139-T05) by ARFRP1 MaxPab polyclonal antibody. Lane 1: ARFRP1 transfected lysate(22.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |