Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARFRP1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ARFRP1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010139-A01 |
| Product name: | ARFRP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ARFRP1. |
| Gene id: | 10139 |
| Gene name: | ARFRP1 |
| Gene alias: | ARL18|ARP|Arp1 |
| Gene description: | ADP-ribosylation factor related protein 1 |
| Genbank accession: | NM_003224 |
| Immunogen: | ARFRP1 (NP_003215, 133 a.a. ~ 201 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT |
| Protein accession: | NP_003215 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |