Brand: | Abnova |
Reference: | H00010137-M05 |
Product name: | RBM12 monoclonal antibody (M05), clone 1D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBM12. |
Clone: | 1D12 |
Isotype: | IgG1 Kappa |
Gene id: | 10137 |
Gene name: | RBM12 |
Gene alias: | HRIHFB2091|KIAA0765|SWAN |
Gene description: | RNA binding motif protein 12 |
Genbank accession: | NM_006047 |
Immunogen: | RBM12 (NP_006038.2, 834 a.a. ~ 932 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG |
Protein accession: | NP_006038.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RBM12 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |