ZNF263 monoclonal antibody (M05), clone 2G6 View larger

ZNF263 monoclonal antibody (M05), clone 2G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF263 monoclonal antibody (M05), clone 2G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ZNF263 monoclonal antibody (M05), clone 2G6

Brand: Abnova
Reference: H00010127-M05
Product name: ZNF263 monoclonal antibody (M05), clone 2G6
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF263.
Clone: 2G6
Isotype: IgG1 Kappa
Gene id: 10127
Gene name: ZNF263
Gene alias: FPM315|ZKSCAN12
Gene description: zinc finger protein 263
Genbank accession: NM_005741
Immunogen: ZNF263 (NP_005732, 201 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRALSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEE
Protein accession: NP_005732
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010127-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010127-M05-1-25-1.jpg
Application image note: ZNF263 monoclonal antibody (M05), clone 2G6 Western Blot analysis of ZNF263 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF263 monoclonal antibody (M05), clone 2G6 now

Add to cart