ENAM monoclonal antibody (M01), clone 2C12 View larger

ENAM monoclonal antibody (M01), clone 2C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ENAM monoclonal antibody (M01), clone 2C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ENAM monoclonal antibody (M01), clone 2C12

Brand: Abnova
Reference: H00010117-M01
Product name: ENAM monoclonal antibody (M01), clone 2C12
Product description: Mouse monoclonal antibody raised against a partial recombinant ENAM.
Clone: 2C12
Isotype: IgG2a Kappa
Gene id: 10117
Gene name: ENAM
Gene alias: ADAI|AI1C|AIH2
Gene description: enamelin
Genbank accession: NM_031889
Immunogen: ENAM (NP_114095, 1043 a.a. ~ 1141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQ
Protein accession: NP_114095
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010117-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010117-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ENAM is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ENAM monoclonal antibody (M01), clone 2C12 now

Add to cart