Brand: | Abnova |
Reference: | H00010116-M09 |
Product name: | FEM1B monoclonal antibody (M09), clone 4B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FEM1B. |
Clone: | 4B12 |
Isotype: | IgG2a Kappa |
Gene id: | 10116 |
Gene name: | FEM1B |
Gene alias: | DKFZp451E0710|FIAA |
Gene description: | fem-1 homolog b (C. elegans) |
Genbank accession: | NM_015322 |
Immunogen: | FEM1B (NP_056137.1, 401 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL |
Protein accession: | NP_056137.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FEM1B is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |