SGK2 monoclonal antibody (M04A), clone 4B12 View larger

SGK2 monoclonal antibody (M04A), clone 4B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SGK2 monoclonal antibody (M04A), clone 4B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about SGK2 monoclonal antibody (M04A), clone 4B12

Brand: Abnova
Reference: H00010110-M04A
Product name: SGK2 monoclonal antibody (M04A), clone 4B12
Product description: Mouse monoclonal antibody raised against a partial recombinant SGK2.
Clone: 4B12
Isotype: IgG1 Kappa
Gene id: 10110
Gene name: SGK2
Gene alias: H-SGK2|dJ138B7.2
Gene description: serum/glucocorticoid regulated kinase 2
Genbank accession: BC065511
Immunogen: SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Protein accession: AAH65511
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010110-M04A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.88 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00010110-M04A-1-11-1.jpg
Application image note: SGK2 monoclonal antibody (M04A), clone 4B12 Western Blot analysis of SGK2 expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SGK2 monoclonal antibody (M04A), clone 4B12 now

Add to cart