SGK2 MaxPab rabbit polyclonal antibody (D01) View larger

SGK2 MaxPab rabbit polyclonal antibody (D01)

H00010110-D01_100uL

New product

384,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SGK2 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr,IP

More info about SGK2 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00010110-D01
Product name: SGK2 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human SGK2 protein.
Gene id: 10110
Gene name: SGK2
Gene alias: H-SGK2|dJ138B7.2
Gene description: serum/glucocorticoid regulated kinase 2
Genbank accession: NM_170693.1
Immunogen: SGK2 (NP_733794.1, 1 a.a. ~ 367 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Protein accession: NP_733794.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00010110-D01-13-15-1.jpg
Application image note: Western Blot analysis of SGK2 expression in transfected 293T cell line (H00010110-T02) by SGK2 MaxPab polyclonal antibody.

Lane 1: SGK2 transfected lysate(41.2 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy SGK2 MaxPab rabbit polyclonal antibody (D01) now

Add to cart