ARPC2 monoclonal antibody (M01), clone 5C8 View larger

ARPC2 monoclonal antibody (M01), clone 5C8

H00010109-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARPC2 monoclonal antibody (M01), clone 5C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ARPC2 monoclonal antibody (M01), clone 5C8

Brand: Abnova
Reference: H00010109-M01
Product name: ARPC2 monoclonal antibody (M01), clone 5C8
Product description: Mouse monoclonal antibody raised against a full length recombinant ARPC2.
Clone: 5C8
Isotype: IgG2b Kappa
Gene id: 10109
Gene name: ARPC2
Gene alias: ARC34|PNAS-139|PRO2446|p34-Arc
Gene description: actin related protein 2/3 complex, subunit 2, 34kDa
Genbank accession: BC000590
Immunogen: ARPC2 (AAH00590, 1 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Protein accession: AAH00590
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010109-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (58.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00010109-M01-1-1-1.jpg
Application image note: ARPC2 monoclonal antibody (M01), clone 5C8 Western Blot analysis of ARPC2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARPC2 monoclonal antibody (M01), clone 5C8 now

Add to cart