Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CTDSP2 monoclonal antibody (M02A), clone 3F11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CTDSP2 monoclonal antibody (M02A), clone 3F11
| Brand: | Abnova |
| Reference: | H00010106-M02A |
| Product name: | CTDSP2 monoclonal antibody (M02A), clone 3F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CTDSP2. |
| Clone: | 3F11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10106 |
| Gene name: | CTDSP2 |
| Gene alias: | OS4|PSR2|SCP2 |
| Gene description: | CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 |
| Genbank accession: | NM_005730 |
| Immunogen: | CTDSP2 (NP_005721, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQ |
| Protein accession: | NP_005721 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |