Brand: | Abnova |
Reference: | H00010106-M02A |
Product name: | CTDSP2 monoclonal antibody (M02A), clone 3F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CTDSP2. |
Clone: | 3F11 |
Isotype: | IgG2b Kappa |
Gene id: | 10106 |
Gene name: | CTDSP2 |
Gene alias: | OS4|PSR2|SCP2 |
Gene description: | CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 |
Genbank accession: | NM_005730 |
Immunogen: | CTDSP2 (NP_005721, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQ |
Protein accession: | NP_005721 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |