Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TSFM monoclonal antibody (M02), clone 1A2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about TSFM monoclonal antibody (M02), clone 1A2
| Brand: | Abnova |
| Reference: | H00010102-M02 |
| Product name: | TSFM monoclonal antibody (M02), clone 1A2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TSFM. |
| Clone: | 1A2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10102 |
| Gene name: | TSFM |
| Gene alias: | COXPD3|EF-TS|EF-Tsmt |
| Gene description: | Ts translation elongation factor, mitochondrial |
| Genbank accession: | NM_005726 |
| Immunogen: | TSFM (NP_005717.2, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVQWLTPVNLALWEAEAGGSLEGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVI |
| Protein accession: | NP_005717.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TSFM is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |