ARPC5 (Human) Recombinant Protein (Q02) View larger

ARPC5 (Human) Recombinant Protein (Q02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARPC5 (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ARPC5 (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00010092-Q02
Product name: ARPC5 (Human) Recombinant Protein (Q02)
Product description: Human ARPC5 partial ORF ( NP_005708.1, 3 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 10092
Gene name: ARPC5
Gene alias: ARC16|MGC88523|dJ127C7.3|p16-Arc
Gene description: actin related protein 2/3 complex, subunit 5, 16kDa
Genbank accession: NM_005717
Immunogen sequence/protein sequence: KNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKA
Protein accession: NP_005708.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00010092-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARPC5 (Human) Recombinant Protein (Q02) now

Add to cart