Brand: | Abnova |
Reference: | H00010085-M01 |
Product name: | EDIL3 monoclonal antibody (M01), clone 4C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EDIL3. |
Clone: | 4C9 |
Isotype: | IgG2a Kappa |
Gene id: | 10085 |
Gene name: | EDIL3 |
Gene alias: | DEL1|MGC26287 |
Gene description: | EGF-like repeats and discoidin I-like domains 3 |
Genbank accession: | NM_005711 |
Immunogen: | EDIL3 (NP_005702, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK |
Protein accession: | NP_005702 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | EDIL3 monoclonal antibody (M01), clone 4C9. Western Blot analysis of EDIL3 expression in human pancreas. |
Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |