Brand: | Abnova |
Reference: | H00010084-A01 |
Product name: | PQBP1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PQBP1. |
Gene id: | 10084 |
Gene name: | PQBP1 |
Gene alias: | MRX55|MRXS3|MRXS8|NPW38|RENS1|SHS |
Gene description: | polyglutamine binding protein 1 |
Genbank accession: | NM_005710 |
Immunogen: | PQBP1 (NP_005701, 184 a.a. ~ 265 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD |
Protein accession: | NP_005701 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PQBP1 polyclonal antibody (A01), Lot # 060707JCS1 Western Blot analysis of PQBP1 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |