TSPAN32 monoclonal antibody (M02), clone 2B4 View larger

TSPAN32 monoclonal antibody (M02), clone 2B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSPAN32 monoclonal antibody (M02), clone 2B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about TSPAN32 monoclonal antibody (M02), clone 2B4

Brand: Abnova
Reference: H00010077-M02
Product name: TSPAN32 monoclonal antibody (M02), clone 2B4
Product description: Mouse monoclonal antibody raised against a partial recombinant TSPAN32.
Clone: 2B4
Isotype: IgG1 Kappa
Gene id: 10077
Gene name: TSPAN32
Gene alias: FLJ17158|FLJ97586|MGC22455|PHEMX|PHMX|TSSC6
Gene description: tetraspanin 32
Genbank accession: NM_005705
Immunogen: TSPAN32 (NP_005696, 194 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD
Protein accession: NP_005696
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010077-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010077-M02-1-25-1.jpg
Application image note: TSPAN32 monoclonal antibody (M02), clone 2B4 Western Blot analysis of TSPAN32 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TSPAN32 monoclonal antibody (M02), clone 2B4 now

Add to cart