TSPAN32 polyclonal antibody (A01) View larger

TSPAN32 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSPAN32 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TSPAN32 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010077-A01
Product name: TSPAN32 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TSPAN32.
Gene id: 10077
Gene name: TSPAN32
Gene alias: FLJ17158|FLJ97586|MGC22455|PHEMX|PHMX|TSSC6
Gene description: tetraspanin 32
Genbank accession: NM_005705
Immunogen: TSPAN32 (NP_005696, 194 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD
Protein accession: NP_005696
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010077-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TSPAN32 polyclonal antibody (A01) now

Add to cart